Package: OdysseusPathwayModule 0.0.1
OdysseusPathwayModule: Cohort Pathway Analysis with Pre-Index Event Support
Provides cohort pathway analysis for Observational Medical Outcomes Partnership (OMOP) Common Data Model databases, including both standard (post-index) and pre-index pathway analyses. The pre-index analysis identifies sequences of events occurring in a lookback window before the target cohort index date. Built on the 'CohortPathways' analysis framework originally developed by Christopher Knoll and the Observational Health Data Sciences and Informatics community through 'WebAPI'. Methodological background and the originating implementation are described in <https://github.com/OHDSI/CohortPathways>.
Authors:
OdysseusPathwayModule_0.0.1.tar.gz
OdysseusPathwayModule_0.0.1.zip(r-4.7)OdysseusPathwayModule_0.0.1.zip(r-4.6)OdysseusPathwayModule_0.0.1.zip(r-4.5)
OdysseusPathwayModule_0.0.1.tgz(r-4.6-any)OdysseusPathwayModule_0.0.1.tgz(r-4.5-any)
OdysseusPathwayModule_0.0.1.tar.gz(r-4.7-any)OdysseusPathwayModule_0.0.1.tar.gz(r-4.6-any)
OdysseusPathwayModule_0.0.1.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
card.svg |card.png
OdysseusPathwayModule/json (API)
| # Install 'OdysseusPathwayModule' in R: |
| install.packages('OdysseusPathwayModule', repos = c('https://a1exanderalexeyuk.r-universe.dev', 'https://cloud.r-project.org')) |
This package does not link to any Github/Gitlab/R-forge repository. No issue tracker or development information is available.
Last updated from:6d689cac96. Checks:9 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | OK | 149 | ||
| source / vignettes | OK | 237 | ||
| linux-release-x86_64 | OK | 142 | ||
| macos-release-arm64 | OK | 155 | ||
| macos-oldrel-arm64 | OK | 79 | ||
| windows-devel | OK | 72 | ||
| windows-release | OK | 75 | ||
| windows-oldrel | OK | 78 | ||
| wasm-release | OK | 115 |
Exports:buildEventSequenceGraphexecuteCohortPathways
Dependencies:backportsbitbit64blobcheckmateclicliprcpp11crayonDatabaseConnectorDBIdbplyrdigestdplyrgenericsgluehmslifecyclemagrittrpillarpkgconfigprettyunitsprogresspurrrR6RcppreadrrJavarlangSqlRenderstringistringrtibbletidyrtidyselecttriebeardtzdburltoolsutf8vctrsvroomwithr
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Build an event sequence graph from pathway analysis results. | buildEventSequenceGraph |
| Execute cohort pathway analysis. | executeCohortPathways |
| Plot an event sequence graph. | plot.event_sequence_graph |
